PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_D5FCF8120.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 213aa    MW: 23294.6 Da    PI: 12.0792
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_D5FCF8120.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.53.8e-3550107259
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                            ++++l+cprC s++tkfCyynnys++qPr++C++C+ryWt+GG+lrnvPvGg++r+  
  Traes_2BL_D5FCF8120.2  50 QQQKLECPRCSSSDTKFCYYNNYSTAQPRHYCRTCHRYWTQGGTLRNVPVGGACRRGG 107
                            7899***************************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.7E-3152105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.28854108IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-175499IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MAPASASLLA GAKRSADAAR DAAELPPAQV TDCICQEGAV TKKNGQSQQQ QQKLECPRCS  60
SSDTKFCYYN NYSTAQPRHY CRTCHRYWTQ GGTLRNVPVG GACRRGGSSK RRRPSAEPQT  120
TFLRLAAAGH AGDARSLRPS APTLPVPHRR RPRLPAAVRS RARRVPLDTG GHGQPLRRAR  180
GAMRLLRPGA RPHWRVGQLR RLRACLATTA TGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ6873900.0FJ687390.1 Triticum aestivum Dof transcription factor 4 (Dof4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5BFU41e-151W5BFU4_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-23Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]